Protein Info for Sama_1701 in Shewanella amazonensis SB2B

Annotation: flavodoxin FldA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 TIGR01752: flavodoxin" amino acids 4 to 168 (165 residues), 236.7 bits, see alignment E=5e-75 PF00258: Flavodoxin_1" amino acids 6 to 160 (155 residues), 95.9 bits, see alignment E=3.8e-31 PF12724: Flavodoxin_5" amino acids 7 to 89 (83 residues), 29.7 bits, see alignment E=1.2e-10 PF12641: Flavodoxin_3" amino acids 7 to 123 (117 residues), 31.8 bits, see alignment E=1.8e-11

Best Hits

Swiss-Prot: 75% identical to FLAV_HAEIN: Flavodoxin (fldA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03839, flavodoxin I (inferred from 100% identity to saz:Sama_1701)

MetaCyc: 75% identical to flavodoxin 1 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Flavodoxin 1" in subsystem Flavodoxin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6A1 at UniProt or InterPro

Protein Sequence (175 amino acids)

>Sama_1701 flavodoxin FldA (RefSeq) (Shewanella amazonensis SB2B)
MATVGLFFGSDTGNTEAVAKMIQKKLGKQMVDVKDIAKSTKEQIADFDLLLFGIPTWYYG
EAQCDWDDFFPELEQIDFTDKLVAIFGCGDQEDYAEYFLDAMGMVRDIVETRGGIIVGHW
PTAGYNFEASKALVDDDHFVGLGIDEDRQPELTEERVDQWVKQIYEEMCLAELAD