Protein Info for Sama_1674 in Shewanella amazonensis SB2B

Annotation: hydrogenase maturation protein HypF (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 771 PF00708: Acylphosphatase" amino acids 7 to 90 (84 residues), 76.5 bits, see alignment E=4e-25 TIGR00143: carbamoyltransferase HypF" amino acids 8 to 763 (756 residues), 726.2 bits, see alignment E=2.1e-222 PF07503: zf-HYPF" amino acids 109 to 142 (34 residues), 60.5 bits, see alignment (E = 2.8e-20) amino acids 159 to 191 (33 residues), 64 bits, see alignment (E = 2.1e-21) PF01300: Sua5_yciO_yrdC" amino acids 213 to 397 (185 residues), 155.6 bits, see alignment E=2.4e-49 PF17788: HypF_C" amino acids 413 to 513 (101 residues), 95.9 bits, see alignment E=5.2e-31 PF22521: HypF_C_2" amino acids 523 to 761 (239 residues), 212.1 bits, see alignment E=2.8e-66

Best Hits

KEGG orthology group: K04656, hydrogenase maturation protein HypF (inferred from 100% identity to saz:Sama_1674)

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypF" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S674 at UniProt or InterPro

Protein Sequence (771 amino acids)

>Sama_1674 hydrogenase maturation protein HypF (RefSeq) (Shewanella amazonensis SB2B)
MSVKISLHITGIVQGVGFRPHVFRLAHELGLGGSIRNDAEGVFIRLMGAQHKVDDFIEKL
RSAPPPLARIDGFTLIADDGSDLDETRFVIEESQAGGEAQVVVSPDKSMCPDCLADIRNP
SDRHYRYPFTNCTNCGPRYTLIKALPYDRKHTSMAHFAMCAQCEAEYKNPLDRRYHAQPV
SCPNCGPKLSLTGPDGSLISSDAEFCLDECARLLKQGAIFAIKGLGGFHLVCDATHEEAV
SSLRTRKVRPAKPLAVMVKDIAMARSFADGAQEEWQLLSSRERPIVIMKKAAEQHRAVPK
DTQHRELAASVAPGIDRIGLFLPYTPLHALLLDSVDRPLVATSANRSGEPIIIAAVDIHQ
KLAGVVDFILDHDRPIVSGCDDSVVQWCAGQLQVIRLARGYAPLAMLSPKPSKSHLMAVG
PQQKNTLGFGLGHNLFLSPHIGDLFSIEAEDYFIRTLESFKRLYQVEPGCVVADHHPDYA
PSRFARRYAQSGDRAIELLTVQHHFAHILSVMAANSRSEPVLGFSFDGTGLGDDMSLWGG
EVLLCSATHFERLGGLMPFALPGGDKASSEPWRVLLSLLAGHLSASQLQGLPCFAHLSQP
MLNNHLKVIGRPGTLQSSSMGRLFDAAAALLGICQRVEFEGQAGMLLEAFAARATGPIPT
LVLEDKQGQWDGAALLVSMLEQMDTLDTSPECLANAFINAIADAIAEKARHYPNLPVALS
GGVFQSRTLANATAQRLSQQGLKLLPWGQVPVNDGGIALGQLWYAVHSFGQ