Protein Info for Sama_1670 in Shewanella amazonensis SB2B

Annotation: hydrogenase expression/formation protein HypE (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR02124: hydrogenase expression/formation protein HypE" amino acids 6 to 334 (329 residues), 446.7 bits, see alignment E=2.2e-138 PF00586: AIRS" amino acids 38 to 149 (112 residues), 79.6 bits, see alignment E=2.4e-26 PF02769: AIRS_C" amino acids 161 to 312 (152 residues), 92.5 bits, see alignment E=3.3e-30

Best Hits

Swiss-Prot: 47% identical to HYPE_AZOVI: Carbamoyl dehydratase HypE (hypE) from Azotobacter vinelandii

KEGG orthology group: K04655, hydrogenase expression/formation protein HypE (inferred from 100% identity to saz:Sama_1670)

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypE" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S670 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Sama_1670 hydrogenase expression/formation protein HypE (RefSeq) (Shewanella amazonensis SB2B)
MSTNSIQLAHGGGGLEMNKLIRNLFFKAFDNCILRNEEDAALLNLQGPTAFTTDSFTVSP
LFFAGGDIGKLAIAGTVNDLAMMGAEPQYLSLGVIIEEGFPMASLETIVASMASELKKCG
AKIVCGDTKVVPKGCADGLFLNTTGVGRIVKPGLSAKRLMPGDAILVSGDIGRHGAAILM
AREGLELESGLVSDCATLWGAVEQLLVHPFDIHAMRDATRGGLSAVLNEWAAASDVMIEV
DEAAVPVSDEVKGLCELYGFEATDLANEGTFVMALPAAQADGALEVLKRFGHCENAVIIG
RVGESPAGRVILHTPWGSNRYLDLPAGELLPRIC