Protein Info for Sama_1655 in Shewanella amazonensis SB2B

Annotation: LacI family transcription regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 signal peptide" amino acids 1 to 13 (13 residues), see Phobius details PF00356: LacI" amino acids 31 to 71 (41 residues), 55 bits, see alignment 1.1e-18 PF00532: Peripla_BP_1" amino acids 103 to 349 (247 residues), 94.9 bits, see alignment E=1.3e-30 PF13407: Peripla_BP_4" amino acids 143 to 343 (201 residues), 43.8 bits, see alignment E=5e-15 PF13377: Peripla_BP_3" amino acids 200 to 360 (161 residues), 112.1 bits, see alignment E=6.2e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_1655)

Predicted SEED Role

"Transcriptional regulator of maltose utilization, LacI family" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S655 at UniProt or InterPro

Protein Sequence (366 amino acids)

>Sama_1655 LacI family transcription regulator (RefSeq) (Shewanella amazonensis SB2B)
MSLPLCVGAVASGPSKYNKSPVMASKATSIDIAYRAGVSQSTVSRALRDSPLVSPETKEK
IRAIARELNYKVDKNASNLRTQNSHTLALLLCEDPTNDDSLINPFFLSMLGSITRATAKQ
GYDLLVSFQQLSSDWHADYEDSNKADGIILLGYGDFVDYEHKLERLLAQNTHFVIWGAEH
NKSTVASVGCDNQQGGLIATEHLLSLGRKSVAFLGDASSHSPEFRDRYLGHVRALKDAGL
VADKRCQVDAISTESAGFDAANKLIRKGAQFDAIFAASDLIAIGAIRALKEAGLRVPEDV
AVVGYDDIPVASFANPPLTTIKQNTQLAGEMLVESLLKLIHGEAVPPRLIPTSLVVRKSC
GIDLGD