Protein Info for Sama_1642 in Shewanella amazonensis SB2B

Annotation: carbonate dehydratase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00484: Pro_CA
  • amino acids 37 to 187 (151 residues), 183.1 bits, E=2.2e-58

Best Hits

Swiss-Prot: 59% identical to CAN_ECOLI: Carbonic anhydrase 2 (can) from Escherichia coli (strain K12)

KEGG orthology group: K01673, carbonic anhydrase [EC: 4.2.1.1] (inferred from 100% identity to saz:Sama_1642)

MetaCyc: 59% identical to carbonic anhydrase 2 (Escherichia coli K-12 substr. MG1655)
Carbonate dehydratase. [EC: 4.2.1.1]

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

• CO₂ fixation into oxaloacetate (anaplerotic) (2/2 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (8/11 steps found)
• cyanate degradation (2/3 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (9/14 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• 3-hydroxypropanoate cycle (3/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (6/18 steps found)
• glyoxylate assimilation (2/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (3/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.1

Sequence Analysis Tools

See A1S642 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Sama_1642 carbonate dehydratase (RefSeq) (Shewanella amazonensis SB2B)
MKLLKPLFDNNRRWAQRILQENPGFFETLAKQQNPEYLWIGCSDSRVPSNQIIDLLPGEV
FVHRNIANMVIHTDLNCLSVLQYAVDVLQVKHIMVVGHYGCGGVRAAMGSARLGLIDNWL
GHLRDIHRLHNDELTNLDDQARFDRLCELNVIEQVANVSESNIVQEAWARGQEVAIHGWI
YGITNGLLTDLDVTVDRETFLGQ