Protein Info for Sama_1608 in Shewanella amazonensis SB2B

Name: uvrC
Annotation: excinuclease ABC subunit C (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 TIGR00194: excinuclease ABC subunit C" amino acids 6 to 585 (580 residues), 662.6 bits, see alignment E=2.8e-203 PF01541: GIY-YIG" amino acids 15 to 90 (76 residues), 39.6 bits, see alignment E=1.6e-13 PF02151: UVR" amino acids 201 to 234 (34 residues), 32.7 bits, see alignment (E = 1.4e-11) PF08459: UvrC_RNaseH_dom" amino acids 381 to 538 (158 residues), 165 bits, see alignment E=3.9e-52 PF14520: HHH_5" amino acids 553 to 605 (53 residues), 45.1 bits, see alignment 3.4e-15 PF00633: HHH" amino acids 575 to 602 (28 residues), 27.6 bits, see alignment (E = 5.6e-10)

Best Hits

Swiss-Prot: 78% identical to UVRC_SHESW: UvrABC system protein C (uvrC) from Shewanella sp. (strain W3-18-1)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 100% identity to saz:Sama_1608)

MetaCyc: 61% identical to UvrABC excision nuclease subunit C (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S609 at UniProt or InterPro

Protein Sequence (606 amino acids)

>Sama_1608 excinuclease ABC subunit C (RefSeq) (Shewanella amazonensis SB2B)
MFDHKAFLKTVSSASGVYRMYDAAAEVIYVGKAKDLKKRLSSYFRTNLPNIKTQALVSNI
ANIDVTLTHSETEALILENDYIKQYMPKYNVLLRDDKSYPYILLSGHKHPRLAYHRGAQR
EKGEYFGPYPNGGAVRESLNLMQKLFPIRQCEDAYYRARSRPCLQYQIGRCSAPCVGKIS
DEDYDEQVRLATLFLRGKDQQVIASLVGKMEAAALAMEYEAAARYRDQIQALRKVAEQQN
VSGQQGDMDVIGVNYASGIACFHILFIREGKIFGSRSYFPAVPDATELGEVLRAFMLQFY
LGNEAHRSIPKEVLLGEEFEDLHELEAAMQDSLGHRLEIKTKVRADRAAFLRLANTNAAN
AVVTKLAHKSTVEQRMELLEEVLGLGAPIQRMECFDISHTMGESTVASCVVFNREGPNKG
EYRRYNISGITGGDDYAAMAQALSRRFDKIERTGKVPDVLFIDGGLGQLRAAMTIVNDKF
AELDRQPLLVGVAKGESRKPGLETLIFGGSEAEFSLESDNPALHLIQHIRDESHRFAITG
HRAKRQQTRNTSTLESIPGIGPKRRKALLQYLGGLQQVKNASVAELAKVPGISAEMAQTI
HDALRG