Protein Info for Sama_1591 in Shewanella amazonensis SB2B

Updated annotation (from data): adhesin-associated MmpL efflux pump
Rationale: Conserved cofit with a putative adhesin (Sama_1588). The MmpL family is involved in efflux of lipids or siderophores (see IPR004869); we speculate that this exports a lipid or saccharide that is attached to the adhesin.
Original annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 768 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 253 to 277 (25 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 325 to 348 (24 residues), see Phobius details amino acids 357 to 380 (24 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details amino acids 614 to 630 (17 residues), see Phobius details amino acids 636 to 654 (19 residues), see Phobius details amino acids 663 to 689 (27 residues), see Phobius details amino acids 710 to 731 (22 residues), see Phobius details amino acids 739 to 764 (26 residues), see Phobius details PF03176: MMPL" amino acids 140 to 399 (260 residues), 43.9 bits, see alignment E=1.6e-15 amino acids 549 to 762 (214 residues), 52.4 bits, see alignment E=4.1e-18 PF02460: Patched" amino acids 167 to 296 (130 residues), 28.2 bits, see alignment E=6e-11

Best Hits

KEGG orthology group: K07003, (no description) (inferred from 100% identity to saz:Sama_1591)

Predicted SEED Role

"FIG005548: transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S5Z2 at UniProt or InterPro

Protein Sequence (768 amino acids)

>Sama_1591 adhesin-associated MmpL efflux pump (Shewanella amazonensis SB2B)
MLERLVNGFESFLFRHRGWVISIFVLLTAFLGYQASQLKMDAAFVKNIPLNHSYMQTYLK
HQKDFGGANSIMVAVEDTSGNIFNPVFFDALKNVHDQLFFIPGIERSQVKSLFSPSTRFT
EVVEDGFAGGPVIPADYVNDDIGLAVVRDNIEKAGIVGRLIAEDYSAAMVSAQLMDFDPQ
TGEPLDTIALAAKLENELRGKYETDTIKVHIIGFAKMAGDVADGAKGVLLFFLIAIAITA
VMVFLFSRSLVLTLLPLSCSLIAVVWQLGLLTVVGFGLDPMSILVPFLVFAIGVSHGVQI
INAVRQRVLDGQQTKAAAASAFRSLLVPGGVALLSDTVGFITLLAIDIGIIRELAISASL
GVAVIIFTNLILLPIVISFFEIKTKEGNGRAERSKAFWQPFSRFADIRVAAVVLLATAGV
YALGLKGASEMKIGDLQGGAPALHADSRYNQDTFFITDHFSITTDVMTIITEAYPEACTY
HDALERIGEFEWQVGNTPGVESTASLASIARKVNAGFNEGNPKWEVLPRNTSSLVQAVGQ
IPTTSGLLNGDCSVMPVYLFLKDHKAETIEAVVAKVKAVSAELNTDKIQFKLASGPVGVM
AATNEAVAEAQTPMMLYVYGAVFVLCLVSFRSLRATIAVILPLYVVSTLAQALMTKLEIG
LAVSTLPVIALGVGIGVDYGIYILSTMAVKLRDGMAVQQAYLEALQERGSAVIFTGLTLA
IGVSTWFFSALKFQMDMGILLTFMFLVNMLGAIIILPALTAVFWPNRR