Protein Info for Sama_1554 in Shewanella amazonensis SB2B

Annotation: GGDEF domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 729 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 37 to 88 (52 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 451 to 470 (20 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 544 to 712 (169 residues), 158.8 bits, see alignment E=5.1e-51 PF00990: GGDEF" amino acids 549 to 709 (161 residues), 143.5 bits, see alignment E=2.6e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_1554)

Predicted SEED Role

"Signaling protein with a acyltransferase and GGDEF domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S5V5 at UniProt or InterPro

Protein Sequence (729 amino acids)

>Sama_1554 GGDEF domain-containing protein (RefSeq) (Shewanella amazonensis SB2B)
MSYFFSASPPRTAIILAFCGFLLNLYPLPLFANVQLILGNAAYVIAAVVLGPRYAVAVAL
SCAAGLFMIWGTTHVFVLFPLEALVLAMATRRGIYSLYAGVGFWLLIGTPLFYLYGLTLT
SLPVSHLPFIAFKQAINGLFYIGLGAVLLLMLPKLTLSGISHPKTPERFSDKLTYSFTLF
ISLAMLIAALLFNQFFIERQQLLIKKNLQNNALHLSQFTFDYLQEHQRAIAQGAQWLSMM
DGGSEKQQHWLTLFNHGYPAFLTMLIANERGHIVAASPAARMMDEAIKKGEYSVADRHYF
KEAFYNQTPFVSPVFMGRGFGSDPIVAVSAPIYSQGRPSHPSGILEGSLDLNRFVLIDKQ
NRHHSEQYLLLTDENNRVIYASAPLNITALSEFASAESGLEYRTSLQLINLHDLTNPNPE
YIYAQEPLANGWRLMVLTPFAPLMQMAETQFLRTCILLIISMGFSFYLARLISRMLTSPL
ETIAHEFNSPGKQSKPLPADAPAEVQTLYQSLKASQQQLLSYQLELEEKVAFRTFELEKA
NQKLQALAERDPLTGLYNRRYTTAGFAPLQAMCERSGEAIAVVILDLDFFKAINDNHGHL
AGDECLRQVAILLTQHFKRDSDLVARYGGEEFLLILPMTNALKIEHHLNLLREQLARHPV
VLPGAQEPIHLSVSVGAAVANASFSDTLEAWLKVADDNLYQAKAEGRNRVVCTLINDEIP
RQQVMDHKP