Protein Info for Sama_1543 in Shewanella amazonensis SB2B

Annotation: putative phosphonate ABC transporter, periplasmic phosphonate-binding protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01098: phosphate/phosphite/phosphonate ABC transporter, periplasmic binding protein" amino acids 19 to 246 (228 residues), 175.9 bits, see alignment E=1e-55 TIGR04553: putative selenate ABC transporter periplasmic binding protein" amino acids 23 to 284 (262 residues), 383.9 bits, see alignment E=3.9e-119 PF12974: Phosphonate-bd" amino acids 26 to 270 (245 residues), 214.6 bits, see alignment E=7.1e-68

Best Hits

KEGG orthology group: K02044, phosphonate transport system substrate-binding protein (inferred from 100% identity to saz:Sama_1543)

Predicted SEED Role

"Phosphonate ABC transporter phosphate-binding periplasmic component (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S5U4 at UniProt or InterPro

Protein Sequence (284 amino acids)

>Sama_1543 putative phosphonate ABC transporter, periplasmic phosphonate-binding protein (RefSeq) (Shewanella amazonensis SB2B)
MKLLRKYLAPLLVVLAPAAMAETFTFTAIPDEDESQLRTRFEKVADYLETKLGVEVKYVP
VKSYSAAVTAFRNNQVQLAWFGGLSGVQARRLVPGSEAIAQGFEDQFFKSYFIAHHSTGL
ERSENFPAIGGYTFTFGSKDSTSGRLMPQFFLERNLGKRPKDLFKRVGFSGDHSRTVSQV
EAGVYQVGAVNYKVWDSMVEAGKVDTSKVKVIWESPVYPDYQWTVRGDLNKRFGDGFKAR
VTQALLEMKDPDLLASFPRQSFVPADNEDFQPVEDVAKAIGLID