Protein Info for Sama_1533 in Shewanella amazonensis SB2B

Annotation: D-amino-acid dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details PF00890: FAD_binding_2" amino acids 20 to 58 (39 residues), 25.5 bits, see alignment 1.5e-09 PF01266: DAO" amino acids 20 to 409 (390 residues), 219 bits, see alignment E=2.7e-68 PF13450: NAD_binding_8" amino acids 22 to 56 (35 residues), 25.9 bits, see alignment 2e-09

Best Hits

KEGG orthology group: K00285, D-amino-acid dehydrogenase [EC: 1.4.99.1] (inferred from 100% identity to saz:Sama_1533)

Predicted SEED Role

"D-amino acid dehydrogenase (EC 1.4.99.1) family protein in hydroxy-L-proline catabolic cluster" in subsystem Proline, 4-hydroxyproline uptake and utilization or Respiratory dehydrogenases 1 (EC 1.4.99.1)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S5T4 at UniProt or InterPro

Protein Sequence (428 amino acids)

>Sama_1533 D-amino-acid dehydrogenase (RefSeq) (Shewanella amazonensis SB2B)
MKTNPMKINAGTPDSVNQQVIVIGAGVIGLANAVTLARRGFKVTVIDKEGVAAGASFGNA
GHFATEQVFPLADPSLLPKLPKMLLDPLGPFRIRPAYFHRALPWFVRFIVNMMPARRQHN
GNAIKALNARSMAATKELLTFCGRADLLVENGSLLVFETQDPRVMEQELALYNDAGIAVR
LLSGDEARALEPDLSDAISGALWFTEVGHTPNPRAICEALADTLKALGGRIEIDSVCSLQ
GGNTPSVTTETGKVTKADKLLLCAGAWSRPLALKLGHRVPLETERGYHLMMPQHSGLKRP
VASYERKFIITPMEDGTRLAGTVEFGGLNAPMSNARADCLLPHARVLLPKVFATARVSEG
KRWMGFRPSLPDSLPVLGESQTPGVYFAFGHQHLGLTWAASSAELLGQLICGETPSIDLS
PYCVKRFD