Protein Info for Sama_1530 in Shewanella amazonensis SB2B

Annotation: hydroxyproline-2-epimerase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF05544: Pro_racemase" amino acids 8 to 331 (324 residues), 420.2 bits, see alignment E=2.7e-130

Best Hits

Swiss-Prot: 85% identical to 4HYPE_SHELP: 4-hydroxyproline 2-epimerase (Shew_2363) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: None (inferred from 100% identity to saz:Sama_1530)

Predicted SEED Role

"4-hydroxyproline epimerase (EC 5.1.1.8)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 5.1.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S5T1 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Sama_1530 hydroxyproline-2-epimerase (RefSeq) (Shewanella amazonensis SB2B)
MMKGTFFCVDAHTCGNPVRLVTSGHPHLQGRTMSEKRQDFLANHDWIRKALMFEPRGHDM
MSGSFLYPPCSDNADAAILFIETSGCLPMCGHGTIGTITAAIETGLLKPRTPGKLVLDVP
AGQIEIDYQQTGAKVDWVRIYNVPAYLAHKDAILDIPGLGTLKVDVSYGGNYYVIVDPQD
NFPGLRHWSAADILRWSPIVRQVAQDTLTCVHPNDPTVRGVSHVLWTGDTISEGSDGANA
VFYGDKAIDRSPCGTGTSARLAQLYARGKLKVGDSYTHESIIGSQFIGRIESATRVGDYD
AIRPSIQGWARVFGQNAITVDDSDPYALGFQVV