Protein Info for Sama_1527 in Shewanella amazonensis SB2B

Annotation: 3-oxoacyl-(acyl carrier protein) synthase III (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 3 to 320 (318 residues), 333.2 bits, see alignment E=7.3e-104 PF00108: Thiolase_N" amino acids 42 to 141 (100 residues), 35.4 bits, see alignment E=1.2e-12 PF08545: ACP_syn_III" amino acids 104 to 181 (78 residues), 103 bits, see alignment E=1e-33 PF08541: ACP_syn_III_C" amino acids 231 to 320 (90 residues), 111.9 bits, see alignment E=2.1e-36

Best Hits

Swiss-Prot: 59% identical to FABH2_VIBPA: 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2 (fabH2) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to saz:Sama_1527)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S5S8 at UniProt or InterPro

Protein Sequence (354 amino acids)

>Sama_1527 3-oxoacyl-(acyl carrier protein) synthase III (RefSeq) (Shewanella amazonensis SB2B)
MQYATITGWGKCVPPAVLTNHDLATFIDTSDEWIKPRTGISQRHVSHVNTSELATVAAHR
ALAAAGIDGSELDMIILATASPDTLIPNIASTVQANVGARCAAFDINAACSGFLYGLGLA
SSQIKSGQCKKVLVIGAERLTFYLDWSRRETAVLFGDGAGAVVVEASDIPGGVLGYELNN
DPDGRDILKAGFGTAMDRFSAESLDFYIQFDGQEIFKRAINGMGKLSAQVLEKCGVDKDA
VDLVIPHQANERIIDTLVSKMRIPKEKAFVNIANYGNTSAATIPIAICDALEKGLIKPND
TILSCAFGAGLTSAALLLKWGERVTPVSISDADLPPCEQTGIELVSRAVNYFCK