Protein Info for Sama_1523 in Shewanella amazonensis SB2B

Updated annotation (from data): actP-like component of lactate uptake system
Rationale: annotated as an acetate transporter, but important for lactate utilization; see Sama_1522 (DUF4212)
Original annotation: sodium/solute symporter family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 572 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 154 to 171 (18 residues), see Phobius details amino acids 182 to 205 (24 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 381 to 408 (28 residues), see Phobius details amino acids 429 to 448 (20 residues), see Phobius details amino acids 454 to 476 (23 residues), see Phobius details amino acids 486 to 507 (22 residues), see Phobius details amino acids 527 to 546 (20 residues), see Phobius details TIGR03648: probable sodium:solute symporter, VC_2705 subfamily" amino acids 7 to 563 (557 residues), 869 bits, see alignment E=6e-266 PF00474: SSF" amino acids 33 to 299 (267 residues), 118 bits, see alignment E=2.4e-38 amino acids 378 to 494 (117 residues), 59.5 bits, see alignment E=1.5e-20

Best Hits

KEGG orthology group: K14393, cation/acetate symporter (inferred from 100% identity to saz:Sama_1523)

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S5S4 at UniProt or InterPro

Protein Sequence (572 amino acids)

>Sama_1523 actP-like component of lactate uptake system (Shewanella amazonensis SB2B)
MDVKTLTYLIVGLSFALYIGIAIWSRAGSTKEFYVAGGGVPPVMNGMATAADWMSAASFI
SLAGIVSFVGYDGSVYLMGWTGGYVLLALCMAPYLRKFGKFTVPDFIGERYYSQAARTVA
VVCAIFICFTYIAGQMRGVGVVFSRFLEVDVDTGVYIGMAVVFFYAVLGGMKGITYTQVA
QYCVLIFAFMVPAIFISVMMTGHIIPQLGFGAELIDAAGNGTGVYLLDKLDGLSTELGFS
QYTEGSKSMIDVFAITAALMVGTAGLPHVIVRFFTVPRVKDARSSAGWALVFIAIMYTTV
PALAAFSRVNMIETINGPDSTGVAYETAPGWIKNWEKTGLIKWDDKNGDGKMYYTKGDAN
EMNIDRDIMVLATPEIANLPAWVIALVAAGGLAAALSTSAGLLLVISTSVSHDLMKKGFA
PNISDKQELLYARIAAAVGIVIAGYFGINPPGFVAAVVAFAFGLAASSLFPAIVMGIFSK
KMNKEGAIAGMVVGLGFTAAYIVYFKFVNPAANVPANWLFGISPEGIGMIGMLINFAVAV
IVAKLTSAVPAHVEEMVEGIRFPKGAGGAQDH