Protein Info for Sama_1499 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 transmembrane" amino acids 74 to 97 (24 residues), see Phobius details amino acids 111 to 135 (25 residues), see Phobius details amino acids 150 to 178 (29 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 310 to 328 (19 residues), see Phobius details amino acids 392 to 411 (20 residues), see Phobius details amino acids 418 to 439 (22 residues), see Phobius details amino acids 450 to 472 (23 residues), see Phobius details amino acids 494 to 515 (22 residues), see Phobius details PF11840: DUF3360" amino acids 23 to 521 (499 residues), 880 bits, see alignment E=2.4e-269

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_1499)

Predicted SEED Role

"FIG01056694: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S5Q0 at UniProt or InterPro

Protein Sequence (521 amino acids)

>Sama_1499 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MSETAYQPEAIGLTETDTATGNDAEKSYRELHRPASEFSSREAYLDHELKIMKPRRWALN
LPGRDFNFEWEDLVPAIAGTIGITVMYSAVMAAWAAGLTERWDHINLGADFIISVVRVEM
LIPALLFCIISSGFINPRANLGGNHGPMIPLIGAIALAGAHPLALAILLGVFGLLLSFFK
GGSRLVNLTSSGVAGGLLVFLGFMGAKSQIESLFSWAGGLEAKHALDYSLGYVAFFILLA
NVVIYALLAKLGKRWLAIPLCSIAAIVMAFALGAGLDLKFTTAPGLPNLNPVYWWGSTET
GWQLGLPNMQHFIASLPFAILAVAMWSPDFLGHRIFQELNYPKGAEKVLMDVDDTMTTCS
LRQMVGTAVGGGNITSSWGTYMIPAAIAKRPIPAGAILLGSLCIIVAIVGYPMDLTTWRP
VMSIALLVGVFLPLLEAGLQMVKDNQSSQAAGICIFGSFVANPVLAWALTMLLDNNGLIG
DKERAANLSFVDRVVIPGLAFVICLAAMLAVGMIEGIPALL