Protein Info for Sama_1472 in Shewanella amazonensis SB2B

Annotation: ABC transporter permease protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 291 to 318 (28 residues), see Phobius details amino acids 347 to 371 (25 residues), see Phobius details amino acids 377 to 400 (24 residues), see Phobius details PF12704: MacB_PCD" amino acids 27 to 260 (234 residues), 136.2 bits, see alignment E=2e-43 PF02687: FtsX" amino acids 298 to 410 (113 residues), 74 bits, see alignment E=1.1e-24

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to saz:Sama_1472)

Predicted SEED Role

"Macrolide-specific ABC-type efflux carrier (TC 3.A.1.122.1)" (TC 3.A.1.122.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S5M3 at UniProt or InterPro

Protein Sequence (417 amino acids)

>Sama_1472 ABC transporter permease protein (RefSeq) (Shewanella amazonensis SB2B)
MMQDTFNQYRAGVVQALGEMLHHKLRTALTLLGMIFGVGAVIAMLSVGEGAEREALKMIE
SMGIKNLVVNARPSEGEALKTVREHSIGLSLRDIESAMETLPFIEAYSAGKQVKVFGLFS
VQGRSDALVQGVTPSYFDLSALKLAEGRLLGDEDEQHFRQLAVLGPEAARSLFPRGDAVG
QRIKINHQWFTVVGVLDEGEKGKSAIEGVKVGGERNQVFIPLATALKKMQFKPLEDELDT
IKFALKEGIDPSLAAKSVEHLLSRRHGNEQDYDIVVPADLLAQHQRTQQIFNIVMACVAG
ISLLVGGIGIMNIMLATILERTSEIGLLRALGATQKDIARQFLIESMVISATGGLIGIGV
GLLLALVISAAAGWPVAWSVFAILLSLLVCMAVGIGFGLYPAKKAARLDPIVALQRD