Protein Info for Sama_1468 in Shewanella amazonensis SB2B

Annotation: putative macrolide efflux ABC transporter, ATP-binding protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 PF00005: ABC_tran" amino acids 21 to 168 (148 residues), 117.3 bits, see alignment E=4.1e-38

Best Hits

Swiss-Prot: 57% identical to YKNY_BACSU: Uncharacterized ABC transporter ATP-binding protein YknY (yknY) from Bacillus subtilis (strain 168)

KEGG orthology group: K02003, (no description) (inferred from 100% identity to saz:Sama_1468)

MetaCyc: 45% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S5L9 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Sama_1468 putative macrolide efflux ABC transporter, ATP-binding protein (RefSeq) (Shewanella amazonensis SB2B)
MISLQALTKSFRMGDAEVQALRGVDIHIRQNEFVAIMGPSGSGKSTLMNIIGCLDRPTSG
NYLLNGSAVGGLSDDALSAVRNREIGFVFQSFHLLPRLSALDNVLLPLRFSETPRGDRQH
AIELLERVGLGQRLDHRPNQLSGGQRQRVAIARALVNRPTLLLADEPTGALDSKTSVEIM
ALFDELHLSGQTIVLVTHEEEVAECAGRIIRMRDGVVQQDKQKPREVSNG