Protein Info for Sama_1453 in Shewanella amazonensis SB2B

Annotation: transporter, putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 72 to 89 (18 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 159 to 174 (16 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details PF04973: NMN_transporter" amino acids 24 to 200 (177 residues), 172.9 bits, see alignment E=3.3e-55 TIGR01528: nicotinamide mononucleotide transporter PnuC" amino acids 29 to 203 (175 residues), 64.7 bits, see alignment E=5.5e-22

Best Hits

KEGG orthology group: K03811, nicotinamide mononucleotide transporter (inferred from 100% identity to saz:Sama_1453)

Predicted SEED Role

"Predicted thiamin transporter PnuT" in subsystem PnuC-like transporters or Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S5K4 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Sama_1453 transporter, putative (RefSeq) (Shewanella amazonensis SB2B)
MQADFWGWLGGAFHSAFGEMQVLSAWEGVAVILAMAYLLLAMKRSRWCWVAAFASTAIYT
VLFYEVALLMESALNVYYMGMAIYGYWLWRQDGQDELKVQRWPLKLHLGIITLTSIASLA
VGHLMATFTEASFPYLDAATTCFAVMTTFLVAKKVLENWLYWVVIDVVSIYLYLSKGLMM
TSLLFVFYVGLAVAGYFVWRAAAAEQRPPELALNS