Protein Info for Sama_1440 in Shewanella amazonensis SB2B

Annotation: biotin synthesis protein BioC (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF13649: Methyltransf_25" amino acids 42 to 127 (86 residues), 49.4 bits, see alignment E=9.3e-17 PF08241: Methyltransf_11" amino acids 42 to 128 (87 residues), 64.5 bits, see alignment E=1.7e-21 PF01209: Ubie_methyltran" amino acids 59 to 132 (74 residues), 27.1 bits, see alignment E=3.8e-10

Best Hits

Swiss-Prot: 44% identical to BIOC_SHEON: Malonyl-[acyl-carrier protein] O-methyltransferase (bioC) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02169, biotin synthesis protein BioC (inferred from 100% identity to saz:Sama_1440)

Predicted SEED Role

"Biotin synthesis protein BioC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S5J1 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Sama_1440 biotin synthesis protein BioC (RefSeq) (Shewanella amazonensis SB2B)
MTTQYDVAEHFSRAHQYDCHNLLQRLTANKLLTKAALGGHLLDIGAGPGTDFSLFPVIRV
TTVDIAFAMCQRLKSLHHSYEAVCADAAALPFSNACFDSLYSNLALQWCPDFTVAVAEAS
RVLKPGGRGHFAMVCDGALPELEAMGFCVNHFAPASMMAAAFSDQDWCELSIDVVTETLY
FDDLRTLLYSIKGVGASARHGAGQGKALRGRTDWLARMDDAERLRTPQGLPLSYQILYVS
AVKRGANL