Protein Info for Sama_1406 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 137 to 154 (18 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 254 to 274 (21 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details PF00892: EamA" amino acids 16 to 154 (139 residues), 62.3 bits, see alignment E=2.9e-21 amino acids 164 to 295 (132 residues), 66.3 bits, see alignment E=1.6e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_1406)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S5F7 at UniProt or InterPro

Protein Sequence (312 amino acids)

>Sama_1406 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MLNLFVDIECRGEKLANLMLLLAAAIWGFGFVAQRLGMESLEPFAFNGLRFVIGAMSLLP
LIWFLKTKGRVKGAGETGFWRRALVGSLGCGGILFIAASFQQVGLLHTTAANAGFITGLY
IVLVPVLGIMLKHSTGLNTWLGCAIAVVGLYFLSVGEDFSISFGDGLQLVGALFWAMHIL
AVDHYATRIAPVVLACGQFLVCALASFVVSLMMETTTLAGVQAAWGSLAYAGLISVGVAY
TLQVLAQKHAHPAHAAIILSLETVFAAIGGMLFLDETLGPRALFGCGLMLFGMLISQIPL
RYLVKSRHQKVT