Protein Info for Sama_1405 in Shewanella amazonensis SB2B

Updated annotation (from data): glucokinase (EC 2.7.1.2)
Rationale: Specifically important for: D-Cellobiose. After cellobiose is cleaved to 2 glucose (by Sama_1404), it would be phosphorylated to enter glycolysis (SEED_correct)
Original annotation: fructokinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 59% identical to MAK_ECOLI: Fructokinase (mak) from Escherichia coli (strain K12)

KEGG orthology group: K00847, fructokinase [EC: 2.7.1.4] (inferred from 100% identity to saz:Sama_1405)

MetaCyc: 59% identical to fructokinase (Escherichia coli K-12 substr. MG1655)
Mannokinase. [EC: 2.7.1.7]; Fructokinase. [EC: 2.7.1.7, 2.7.1.4]

Predicted SEED Role

"Glucokinase, ROK family (EC 2.7.1.2)" in subsystem Beta-Glucoside Metabolism (EC 2.7.1.2)

MetaCyc Pathways

Bifidobacterium shunt (13/15 steps found)
heterolactic fermentation (15/18 steps found)
superpathway of anaerobic sucrose degradation (15/19 steps found)
glycogen degradation I (7/8 steps found)
glycolysis III (from glucose) (9/11 steps found)
glycogen degradation II (5/6 steps found)
sucrose degradation II (sucrose synthase) (4/5 steps found)
homolactic fermentation (9/12 steps found)
sucrose biosynthesis II (6/8 steps found)
sucrose degradation III (sucrose invertase) (3/4 steps found)
sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
D-sorbitol degradation I (2/3 steps found)
GDP-α-D-glucose biosynthesis (2/3 steps found)
trehalose degradation V (2/3 steps found)
UDP-N-acetyl-D-glucosamine biosynthesis II (4/6 steps found)
D-mannose degradation II (1/2 steps found)
trehalose degradation I (low osmolarity) (1/2 steps found)
trehalose degradation II (cytosolic) (1/2 steps found)
glucose and glucose-1-phosphate degradation (3/5 steps found)
mannitol cycle (3/5 steps found)
mannitol degradation II (2/4 steps found)
sucrose degradation I (sucrose phosphotransferase) (1/3 steps found)
trehalose degradation IV (1/3 steps found)
chitin biosynthesis (5/9 steps found)
1,5-anhydrofructose degradation (2/5 steps found)
CMP-2-keto-3-deoxy-D-glycero-D-galacto-nononate biosynthesis (1/4 steps found)
sucrose degradation VII (sucrose 3-dehydrogenase) (1/4 steps found)
1,3-propanediol biosynthesis (engineered) (4/9 steps found)
superpathway of CMP-sialic acids biosynthesis (4/15 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.2, 2.7.1.4

Use Curated BLAST to search for 2.7.1.2 or 2.7.1.4 or 2.7.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S5F6 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Sama_1405 glucokinase (EC 2.7.1.2) (Shewanella amazonensis SB2B)
MYRSGIDLGGTKIELVTLNEKGEEVFRKRVPTPKDYRATLEAVAGLVHDSEKETGQVSSV
GIGIPGVVSAVTGRVKNSNAVWLNGQPMDKDLGAMLGREVRIANDANCFAVSESVDGGGA
GKTLVFGAILGTGCGAGIAINHKVHGGGNGIGGEWGHNPLPWMTADEFNSTRCFCGNADC
IETFVSGTGFVRDFRAHGGEAASGIEIVALMGKGEPLAEAAFGRFIDRLARALAHVINLL
DPDVIVLGGGVSNIDEIYEYLPALLPKYVLGGECATKVVKNHHGASSGVRGAAWLWAPGE
QAALPGLQEL