Protein Info for Sama_1401 in Shewanella amazonensis SB2B

Updated annotation (from data): D-cellobiose transporter (MFS superfamily)
Rationale: Specific phenotype on cellobiose and no other transporter for this compound was apparent in the fitness data. Also, this protein is 70% identical to bglT from S. fridgimarina, which is a cellobiose transporter (PMC2996990).
Original annotation: sugar (glycoside-Pentoside-hexuronide) transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 20 to 51 (32 residues), see Phobius details amino acids 78 to 95 (18 residues), see Phobius details amino acids 107 to 133 (27 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 262 to 280 (19 residues), see Phobius details amino acids 292 to 310 (19 residues), see Phobius details amino acids 316 to 337 (22 residues), see Phobius details amino acids 358 to 386 (29 residues), see Phobius details amino acids 399 to 420 (22 residues), see Phobius details TIGR00792: sugar (Glycoside-Pentoside-Hexuronide) transporter" amino acids 7 to 440 (434 residues), 422.9 bits, see alignment E=6.6e-131 PF13347: MFS_2" amino acids 10 to 426 (417 residues), 344.7 bits, see alignment E=6.6e-107 PF07690: MFS_1" amino acids 20 to 344 (325 residues), 59.6 bits, see alignment E=2.7e-20

Best Hits

KEGG orthology group: K03292, glycoside/pentoside/hexuronide:cation symporter, GPH family (inferred from 100% identity to saz:Sama_1401)

Predicted SEED Role

"Predicted beta-glucoside transporter, GPH family" in subsystem Beta-Glucoside Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S5F2 at UniProt or InterPro

Protein Sequence (444 amino acids)

>Sama_1401 D-cellobiose transporter (MFS superfamily) (Shewanella amazonensis SB2B)
MLSVREKIAYGLGDTASNIVFQTVMLFLTFFYTDIFGISAAYVGTMFLAVRIMDAVTDPL
MGYLADRTNTRWGRYRPYLLWFAFPFAAISVLAFTTPDLSESGKEWYAFATYALLMLAYT
AINIPYCALGAALTTNPAERVSVQSYRFVFAMLGGVMVSALTLPLVDFFGQGDKAKGYQL
TILAMSIVGTVMFLLCFIGTKERDFSSDDNSGNFKAASKALWANDQWRVLSAAAIFLLTG
LVLKSTLAIYYVKYFLGREDMISVFVTSGVVGNIFGVALAKKLADKMCKVKAYIRLQLIA
AALCMAAWFVPADQYVLALVFYIAWNFTINMGTPLLWAKMADTVDYGQFKTGVRTTGLVY
SSVIFFIKLGLAIGGALGGWLLAAYGYQPDVAQTEETRAGILLCFTLYPALASIAVAFVM
RHYTLDSQRVAEISVSLQQKHSGT