Protein Info for Sama_1378 in Shewanella amazonensis SB2B

Annotation: enoyl-CoA hydratase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 9 to 256 (248 residues), 192.2 bits, E=1.1e-60
• PF16113: ECH_2
  • amino acids 23 to 184 (162 residues), 88.7 bits, E=5.4e-29

Best Hits

Swiss-Prot: 39% identical to ECHA8_MYCTU: Probable enoyl-CoA hydratase echA8 (echA8) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 100% identity to saz:Sama_1378)

Predicted SEED Role

"Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17) / Enoyl-CoA hydratase [isoleucine degradation] (EC 4.2.1.17)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 4.2.1.17)

MetaCyc Pathways

• oleate β-oxidation (33/35 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (21/26 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (5/5 steps found)
• fatty acid β-oxidation I (generic) (6/7 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• fatty acid salvage (5/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• adipate degradation (4/5 steps found)
• L-valine degradation I (6/8 steps found)
• L-isoleucine degradation I (4/6 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• valproate β-oxidation (6/9 steps found)
• adipate biosynthesis (3/5 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• propanoate fermentation to 2-methylbutanoate (3/6 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
• pyruvate fermentation to butanoate (3/7 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
• 6-gingerol analog biosynthesis (engineered) (2/6 steps found)
• glycerol degradation to butanol (9/16 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
• pyruvate fermentation to butanol I (3/8 steps found)
• benzoyl-CoA degradation I (aerobic) (2/7 steps found)
• 3-phenylpropanoate degradation (4/10 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• 2-methylpropene degradation (2/8 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
• phenylacetate degradation I (aerobic) (2/9 steps found)
• superpathway of phenylethylamine degradation (3/11 steps found)
• methyl tert-butyl ether degradation (2/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
• L-glutamate degradation VII (to butanoate) (3/12 steps found)
• L-tryptophan degradation III (eukaryotic) (4/15 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (6/18 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (3/17 steps found)
• toluene degradation VI (anaerobic) (3/18 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

See A1S5C9 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Sama_1378 enoyl-CoA hydratase (RefSeq) (Shewanella amazonensis SB2B)
MAFLIERIEGNTAILTISNPPANTWTRESLNELKEKVLELNDNNEIYALVLTGEGEKFFS
AGADLKLFADGDKGNAATMAKAFGEAFETLSAFRGVSIAAINGYAMGGGLEVALACDIRI
AEIQAVMALPEATVGLLPCAGGTQNLTALVGEGWAKRMILCGERIDATKALNLGLVEEVV
EKGESLSAAIALAAKVAKQSPSAVAVCKKLIQSGRNMPRTQALPLERELFVGLFDTEDQA
EGVNAFLEKRAAQWKNR