Protein Info for Sama_1372 in Shewanella amazonensis SB2B

Annotation: short chain dehydrogenase family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 246 to 263 (18 residues), see Phobius details PF00106: adh_short" amino acids 33 to 217 (185 residues), 70.2 bits, see alignment E=1.7e-23 PF13561: adh_short_C2" amino acids 38 to 182 (145 residues), 35.6 bits, see alignment E=7.7e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_1372)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S5C3 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Sama_1372 short chain dehydrogenase family protein (RefSeq) (Shewanella amazonensis SB2B)
MSIHPSLNLVQHGLSPYHGSPVLLLNILMTQATAIIVGASSHLGRELVTQLTQEGTRVGV
LVPEPELMTEFIQSLGGNVEIEALPITEPERAIAAFENLWQRMGGAHLVLVNTGLNSYHP
DLPWQIDADIIKVNVQGFALICNTAFRLLRLQGYGQLAAINSIAGQRGGPAVAYHASKAF
AQNYLEGLSMHAQRLKLPITITDLQLGLLDKAAMQQSRFWLQPLPKVATQILHALKKGKR
RAYITRRWALVAWLIRLLPEYIYNTRHWKKKGKH