Protein Info for Sama_1342 in Shewanella amazonensis SB2B

Annotation: phosphinothricin N-acetyltransferase, putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF13420: Acetyltransf_4" amino acids 2 to 153 (152 residues), 57.4 bits, see alignment E=4.5e-19 PF13302: Acetyltransf_3" amino acids 2 to 136 (135 residues), 37.1 bits, see alignment E=1.3e-12 PF00583: Acetyltransf_1" amino acids 15 to 135 (121 residues), 52.9 bits, see alignment E=1.1e-17 PF13673: Acetyltransf_10" amino acids 27 to 142 (116 residues), 25.7 bits, see alignment E=2.5e-09 PF13508: Acetyltransf_7" amino acids 52 to 134 (83 residues), 28.2 bits, see alignment E=5.2e-10

Best Hits

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 100% identity to saz:Sama_1342)

Predicted SEED Role

"Phosphinothricin N-acetyltransferase"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.183

Use Curated BLAST to search for 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S593 at UniProt or InterPro

Protein Sequence (171 amino acids)

>Sama_1342 phosphinothricin N-acetyltransferase, putative (RefSeq) (Shewanella amazonensis SB2B)
MIRHAALHDASAVADIYNHYIESTAITFEETPLQAAEIAARIQHVQAAGLPWLVALEGNA
LTGYAYATKWKERSAYRFTVETTVYVAPNGHGKGVGTALYQALIERLKILKVNSVIGGIT
LPNPASIALHEKMGMKKVAHFQNIGYKFGQWQDVGYWQLNLQTVPGLDSSP