Protein Info for Sama_1338 in Shewanella amazonensis SB2B

Name: lpxK
Annotation: tetraacyldisaccharide 4'-kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02606: LpxK
  • amino acids 16 to 335 (320 residues), 385.4 bits, E=1.1e-119
• TIGR00682: tetraacyldisaccharide 4'-kinase
  • amino acids 22 to 323 (302 residues), 268.8 bits, E=2.9e-84

Best Hits

Swiss-Prot: 100% identical to LPXK_SHEAM: Tetraacyldisaccharide 4'-kinase (lpxK) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K00912, tetraacyldisaccharide 4'-kinase [EC: 2.7.1.130] (inferred from 100% identity to saz:Sama_1338)

Predicted SEED Role

"Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130)" in subsystem KDO2-Lipid A biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 2.7.1.130)

MetaCyc Pathways

• superpathway of (Kdo)₂-lipid A biosynthesis (15/17 steps found)
• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (15/25 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.130

Sequence Analysis Tools

See A1S589 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Sama_1338 tetraacyldisaccharide 4'-kinase (RefSeq) (Shewanella amazonensis SB2B)
MQSFVHKIWYQGHPAAWLLLPLSLLFWLVSSLRRAAFRLGLKRSERLPVPVVVVGNITAG
GSGKTPTVLYLIELLRREGWRPGVISRGYGASFDGELDVVAGMSPAQVGDEPAMIAMRTG
IPMVVGRNRIKAAHKLLQCHDVNVILCDDGLQHYALERDVEILVIDGERRFGNGWLLPAG
PLREGAWRKNSVNFVLCNGASAEADEYAMTLEPTGLVAVAAIHGKSQAKDNSHNAQDNAT
PRPGDTVNAMAGIGNPQRFFSTLMAQGFVLEKAHEFADHMAFSETDIATIDDGRPLLMTE
KDAVKCREFAKQHWWYLAVDANLPPTFSTRLLDALNRAATAKQGNTHGL