Protein Info for Sama_1336 in Shewanella amazonensis SB2B

Annotation: DNA internalization-related competence protein ComEC/Rec2 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 765 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 282 to 299 (18 residues), see Phobius details amino acids 319 to 339 (21 residues), see Phobius details amino acids 360 to 382 (23 residues), see Phobius details amino acids 393 to 417 (25 residues), see Phobius details amino acids 423 to 442 (20 residues), see Phobius details amino acids 449 to 473 (25 residues), see Phobius details amino acids 481 to 498 (18 residues), see Phobius details PF13567: DUF4131" amino acids 25 to 164 (140 residues), 53.7 bits, see alignment E=3.2e-18 TIGR00361: DNA internalization-related competence protein ComEC/Rec2" amino acids 98 to 726 (629 residues), 385.4 bits, see alignment E=4.5e-119 PF03772: Competence" amino acids 196 to 476 (281 residues), 185.2 bits, see alignment E=2.4e-58 TIGR00360: ComEC/Rec2-related protein" amino acids 218 to 403 (186 residues), 83.9 bits, see alignment E=1.6e-27 PF00753: Lactamase_B" amino acids 508 to 684 (177 residues), 46.1 bits, see alignment E=8.7e-16

Best Hits

KEGG orthology group: K02238, competence protein ComEC (inferred from 100% identity to saz:Sama_1336)

Predicted SEED Role

"DNA internalization-related competence protein ComEC/Rec2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S587 at UniProt or InterPro

Protein Sequence (765 amino acids)

>Sama_1336 DNA internalization-related competence protein ComEC/Rec2 (RefSeq) (Shewanella amazonensis SB2B)
MKNPFLLGFCALVISSLLWPVLPPWPACLLLLVALGCYRKLPVLSGALTAVAWVAVYTHM
LFDYSHLQQAGDSWVRGEIIAPVSDSGDWQSIDIRLVKPKLIWPVEGNIRLNWRTTDQIR
PGEQWEFRLAPRSITSPLNEGAFNGQRYLLSRHVGIKARVLEARKVSEASGLRGLLLEHI
GHAISEKPRQALLYPLLTGEQQGIDAQTWQRLRQTGTGHLMAISGLHMSVLGAWLLLLCR
ALLTSFAPRQDRRNLVIAMIVATVGCLLYGLLAGMGIPTRRAFIMLALVVLLTLSRRFAS
PWERLLYALAAVLFLDPLSPLSAGFWLSFGAIVIMLLLLDRPPAHLEGVPGRLKHYLMSL
VTLQLALSIGLGVLQLVLFGGVSVHSLWINLLMVPWFSLVAIPLALAGLVFFVLLLPFGI
LADWAFTPALMALIPLDGLLTFSDHLPGAWISVPAQLIAPLCFAIAGAVLLFLPLARGVK
WVSASLLLPLLITLSVKGGPQWQMHLLDVGQGLAVVVFSRDQTLVYDTGLAFGDTFSHGE
RTLVPFLRAKGRNHIDVLVISHEDKDHAGGAAALARAMPVHLLISDTRAARDTLAMEHAP
CRPQAFALGNLWVEVLSPADSPAGRVDNNASCVVTVGDGHSRLLLPGDIEAEGETRLLGS
GEALNANVLVAPHHGSLTSSTPAFVAGVAPAITLFAAGANNRYGFPKDAVVQRYLAQGSQ
TFTAADTGQISLYLDDEITVKTYRGSLAPFWYNRVFGVGGRPITE