Protein Info for Sama_1319 in Shewanella amazonensis SB2B

Updated annotation (from data): symporter for L-glutamate, L-glutamine, and L-aspartate
Rationale: Specifically important for utilization of L-glutamate or L-glutamine as carbon sources or L-aspartate as a nitrogen source. Glutamine is probably cleaved by a cytoplasmic glutaminase (Sama_2487), so glutamine is probably a substrate.
Original annotation: sodium:dicarboxylate symporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 48 to 72 (25 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details amino acids 268 to 284 (17 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 337 to 381 (45 residues), see Phobius details PF00375: SDF" amino acids 11 to 407 (397 residues), 451.4 bits, see alignment E=1.4e-139

Best Hits

Swiss-Prot: 46% identical to GLT_PYRHO: Glutamate transporter homolog (PH1295) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: K03309, dicarboxylate/amino acid:cation (Na+ or H+) symporter, DAACS family (inferred from 100% identity to saz:Sama_1319)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S570 at UniProt or InterPro

Protein Sequence (437 amino acids)

>Sama_1319 symporter for L-glutamate, L-glutamine, and L-aspartate (Shewanella amazonensis SB2B)
MAAAQSSKIGLTGKILIGMGAGILIGLLLRNFFGGSEWVQDYITEGFFHVIGTIFINSLK
MLVVPLVFISLVCGTCSLSEPSKLGRLGGKTLAFYLFTTAIALVVAISAAVLVQPGNASL
ASESMQYSAKEAPSLADVLINIVPSNPMKALSEGNMLQIIIFAVIFGFAISHIGERGRRV
AALFDDLNEVIMRVVTLIMQLAPYGVFALMGKLALTLGMETLESVIKYFMLVLVVLLFHG
FVVYPTLLKLFSGLSPLMFIRKMRDVQLFAFSTASSNATLPVTMEASEHRLGADNKVASF
TLPLGATINMDGTAIMQGVATVFIAQVFGIDLTITDYAMVVMTATLASIGTAGVPGVGLV
MLAMVLNQVGLPVEGIALILGVDRMLDMVRTAVNVTGDTVATVVIAKSEGALNEAVFNDP
KAGKTAGSFDAEVHRGE