Protein Info for Sama_1312 in Shewanella amazonensis SB2B

Name: recR
Annotation: recombination protein RecR (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 TIGR00615: recombination protein RecR" amino acids 2 to 196 (195 residues), 237 bits, see alignment E=6.2e-75 PF21176: RecR_HhH" amino acids 7 to 51 (45 residues), 74.9 bits, see alignment 8.8e-25 PF02132: RecR_ZnF" amino acids 54 to 74 (21 residues), 33.2 bits, see alignment (E = 8.8e-12) PF13662: Toprim_4" amino acids 81 to 172 (92 residues), 87.1 bits, see alignment E=1.8e-28 PF01751: Toprim" amino acids 82 to 168 (87 residues), 43.1 bits, see alignment E=9.7e-15 PF21175: RecR_C" amino acids 174 to 196 (23 residues), 46.4 bits, see alignment (E = 5.7e-16)

Best Hits

Swiss-Prot: 100% identical to RECR_SHEAM: Recombination protein RecR (recR) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K06187, recombination protein RecR (inferred from 100% identity to saz:Sama_1312)

MetaCyc: 65% identical to recombination mediator protein RecR (Escherichia coli K-12 substr. MG1655)
RXN0-2606

Predicted SEED Role

"Recombination protein RecR" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S563 at UniProt or InterPro

Protein Sequence (199 amino acids)

>Sama_1312 recombination protein RecR (RefSeq) (Shewanella amazonensis SB2B)
MKFSPLVDELIQSLRCLPGVGPKSAQRMAFALLESDRKAGIRLADTLSRAMSDVGHCQKC
RTFTEQSLCPICSSSRRGEADTLCVVETPADVLAIESGGHFQGRYFVLQGHLSPLDGIGP
EELGLSLLEGQLVGGGISELILATNPTVEGDATAHYIADIARRAGVAVSRIAHGVPVGGE
LEYVDSTTLALSFNGRLPL