Protein Info for Sama_1291 in Shewanella amazonensis SB2B

Annotation: Serine O-acetyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00640, serine O-acetyltransferase [EC: 2.3.1.30] (inferred from 100% identity to saz:Sama_1291)

Predicted SEED Role

"Serine acetyltransferase (EC 2.3.1.30)" in subsystem Conserved gene cluster possibly involved in RNA metabolism or Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.3.1.30)

MetaCyc Pathways

superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
L-cysteine biosynthesis I (2/2 steps found)
seleno-amino acid biosynthesis (plants) (3/5 steps found)
L-cysteine biosynthesis VII (from S-sulfo-L-cysteine) (2/4 steps found)
L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
N-3-oxalyl-L-2,3-diaminopropanoate biosynthesis (1/4 steps found)
D-cycloserine biosynthesis (1/6 steps found)
superpathway of seleno-compound metabolism (8/19 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S542 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Sama_1291 Serine O-acetyltransferase (RefSeq) (Shewanella amazonensis SB2B)
MGVISRLKEDIASIYHRDPAARSAIEILLNYPGMHAIWLHRISHKLWKRDWRFLARCLST
FSRWLTGVEIHPGATIGRRFFIDHGMGIVIGETAEIGDDCTLYHGVTLGGTSWNAGKRHP
TLENNVVVGAGAKILGPITMKEGSRVGSNSVVVKDVPEHTTVVGIPGRAVAQPSSQSKET
TERRSAMAKKYGFDAYAVSPDNPDPVANAIGQMLDHMHLMDSKVQDLCQELQRLGGNVCT
ERLPELDVGEFSEAEAAAAEKRQNALDEFDPSI