Protein Info for Sama_1282 in Shewanella amazonensis SB2B

Annotation: signal transduction histidine kinase, LytS (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 41 to 58 (18 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 135 to 159 (25 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details PF07694: 5TM-5TMR_LYT" amino acids 24 to 193 (170 residues), 197.9 bits, see alignment E=9.4e-63 PF06580: His_kinase" amino acids 366 to 444 (79 residues), 92.8 bits, see alignment E=1.3e-30

Best Hits

Swiss-Prot: 61% identical to BTSS_SHIFL: Sensor histidine kinase BtsS (btsS) from Shigella flexneri

KEGG orthology group: K02478, two-component system, LytT family, sensor kinase [EC: 2.7.13.3] (inferred from 100% identity to saz:Sama_1282)

MetaCyc: 61% identical to high-affinity pyruvate receptor (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Autolysin sensor kinase (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S533 at UniProt or InterPro

Protein Sequence (569 amino acids)

>Sama_1282 signal transduction histidine kinase, LytS (RefSeq) (Shewanella amazonensis SB2B)
MSLILLLTQQMCLYLVFVYLASKTPLFKVLTENAPRLPHKVIIYVIFSAFCIMATYFGEQ
THGAIANTRAMGAVLGGLLGGPVTGFFVGLTGGLHRYSMGGFTDVACALSTTLEGLSAGL
ISLTLRRAGKTELIFHPLVAGFVTFYAEVMQMLIILLVAKPYDEAWALVRQIAPPMLLVN
SMGSALFMSMLKDQKAMFDKLSSTFSTKALKIAERSVGLLSQGFNEKTSAQVARIVIEET
NVGAVAITDREKLLAFIGIGADHHIPGTPIASAITLEAIRDNKVMFADGMEVPYACSISS
QCRLGSSLVIPLRSDTEVIGTIKLYEPKNKLFLNINRTLGEGIAKLLSNQILYGRVEQQK
NLLTQTELKLLQAQVNPHFLFNALNTIGAIIRRDPDMARGLLQKLSQFLRINLKRSPEMV
TLADELEHIDAYLGIEKARFIDRLSVNIAIPPELMHQKLPAFTLQPIIENAVKHGTSQLL
SPGVIDVSGRQQEQMLVLEVADNAGLYRPTPNNEGLGMNLVHKRIQNQFGEQYGVTVECE
PDTLTRVRICLPINVDTPIDTDNSGDKPR