Protein Info for Sama_1281 in Shewanella amazonensis SB2B

Annotation: putative two-component response-regulatory protein YehT (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF00072: Response_reg" amino acids 5 to 111 (107 residues), 84.4 bits, see alignment E=6.5e-28 PF04397: LytTR" amino acids 142 to 233 (92 residues), 70.5 bits, see alignment E=1.2e-23

Best Hits

Swiss-Prot: 68% identical to Y2823_SHEON: Uncharacterized response regulatory protein SO_2823 (SO_2823) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02477, two-component system, LytT family, response regulator (inferred from 100% identity to saz:Sama_1281)

Predicted SEED Role

"FIG001014_Response regulator of the LytR/AlgR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S532 at UniProt or InterPro

Protein Sequence (236 amino acids)

>Sama_1281 putative two-component response-regulatory protein YehT (RefSeq) (Shewanella amazonensis SB2B)
MISCILVDDEPFAREALAELLVRHPDVNIVAQASNAIEAIQAINQHKPALLFLDIQMPRI
SGMELLAMLDKDTMPRVVFVTAFDEYAIKAFELHAFDYLLKPIDDARLANTMDRVRKDQR
PQDVTSLAPERLAHLPCFSGNRLKVVPIEEVEYVFSDVGGIHVSTANGRVHTQMTLKLLE
EKTPLIFCHRQYLIAPAAIAEIVLLDGGAEVVTRSGARVPVSRRYLKELKSHFGFL