Protein Info for Sama_1266 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 108 to 125 (18 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 236 to 254 (19 residues), see Phobius details PF01925: TauE" amino acids 17 to 252 (236 residues), 160.1 bits, see alignment E=3.9e-51

Best Hits

Swiss-Prot: 59% identical to YFCA_ECO57: Probable membrane transporter protein YfcA (yfcA) from Escherichia coli O157:H7

KEGG orthology group: K07090, (no description) (inferred from 100% identity to saz:Sama_1266)

Predicted SEED Role

"Putative membrane protein YfcA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S517 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Sama_1266 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MDVFMDFAFSIELAALLFFVAMLAGFIDAIAGGGGLLTIPALMWAGLSPAAALATNKLQA
CGGSFFASLYFVRKKMVDLASIKLDIFCAFVGAAIGTIAVQLIDASMLKTLLPFLMLAIG
GYFLFSKKVSEDDRHRVLTPTLFAFSAALGIGFYDGFFGPGTGSFFALAFVSLAGFGLAK
ATAHAKVLNFATNISSLIFFALGGKVVWMLGGLMLLGQAMGATLGSRLVVNKGTAIIKPL
VVLMSVVMSTKLLGDQFQWW