Protein Info for Sama_1253 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 593 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF14559: TPR_19" amino acids 13 to 78 (66 residues), 35.3 bits, see alignment E=7.9e-12 PF13432: TPR_16" amino acids 13 to 60 (48 residues), 20.5 bits, see alignment 3.8e-07 amino acids 108 to 164 (57 residues), 18.2 bits, see alignment 1.9e-06 PF07719: TPR_2" amino acids 104 to 136 (33 residues), 23.9 bits, see alignment (E = 2.1e-08) PF13181: TPR_8" amino acids 104 to 136 (33 residues), 13.4 bits, see alignment (E = 5e-05) PF13174: TPR_6" amino acids 104 to 135 (32 residues), 12.9 bits, see alignment (E = 9.7e-05) PF13759: 2OG-FeII_Oxy_5" amino acids 494 to 587 (94 residues), 65.7 bits, see alignment E=2.7e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_1253)

Predicted SEED Role

"TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S504 at UniProt or InterPro

Protein Sequence (593 amino acids)

>Sama_1253 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MNTQQVFISGVQLFQAGNFAGASQCFSTVVQQIPHHLDAHFLLAQCRRKLNDPDGAEKIL
RWLLSVRRTPEYLIMLANINIAKQAWIEAETQLRDAIELKPSFDAWVNLGRLYFVLENWS
QAKVALQRSLKLRPNDVGSLISLIECYRRLGEVEQAISELKLLVHNADLNLSQLHKIAFL
LHSLDHSQEAFDLLRFRIPVEGFNEGLMGLLAKLVLQHESIDGAKEFITGMLSVPSIKRR
ALDLLFRLEWESGKDSAFIHYESVLKSTPSEDVLEDYLRKLIKCGRFEFAYQQLNGLNEG
QPNNPVLKFLKAFIVCELGHFDEALTEINALIAQSPEDGQFIEQKVKTLLSMKRAEEAFE
LMQLRLKLPDVKQGTYALYASVLKLSGREQEYRRLYDFDKHINCIQIDLTSNNLHERLKQ
KLTGMHSGNREPFEQSLRGGSQTTGHLFESGDPDIAELKERLMKQLAELFSRVDFSSSAP
LNSLNVGEFTITDSWSVLLKDTHFHANHFHNAGDLSACLYLDVSGVNSHPGEGWIKFGEA
ELGGWVQDCPDYCVKPDTGLLVVFPSYMWHGTTPFLSDKQRMTIAFDLRFLRD