Protein Info for Sama_1242 in Shewanella amazonensis SB2B

Annotation: methionine gamma-lyase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF01053: Cys_Met_Meta_PP" amino acids 8 to 389 (382 residues), 501.5 bits, see alignment E=2.4e-154 PF00155: Aminotran_1_2" amino acids 52 to 188 (137 residues), 22.7 bits, see alignment E=1.1e-08 PF01041: DegT_DnrJ_EryC1" amino acids 61 to 182 (122 residues), 38.4 bits, see alignment E=1.8e-13

Best Hits

Swiss-Prot: 54% identical to MEGL_FUSNP: L-methionine gamma-lyase (mgl) from Fusobacterium nucleatum subsp. polymorphum

KEGG orthology group: K01761, methionine-gamma-lyase [EC: 4.4.1.11] (inferred from 100% identity to saz:Sama_1242)

MetaCyc: 50% identical to MdeA (Pseudomonas putida)
Methionine gamma-lyase. [EC: 4.4.1.11]

Predicted SEED Role

"Methionine gamma-lyase (EC 4.4.1.11)" in subsystem Methionine Degradation (EC 4.4.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S4Z3 at UniProt or InterPro

Protein Sequence (392 amino acids)

>Sama_1242 methionine gamma-lyase (RefSeq) (Shewanella amazonensis SB2B)
MQEKSKLATLVVHGGHERDAMGALVSPLYQSATFVFDNARQGGARFAGDEAGYIYTRLGN
PTTAELERKLAILEGAEEAAATASGMGAVSAALLANLSQGDHLVASRAVYGCTFALMTDL
MARFGIEVTLVDFKEPAAIEAAIRDNTRAIFCETPVNPHLDVFDLDAIAAIGKRHGLLTI
VDNTFMTPLLQRPLDHGIDMVIHSATKYLNGHGDVIAGMVAGSKEQIDKVKYQIIKDIGA
VMSPHDAWLILRGMKTLDVRVQRHCDNAEKIADFLEAHPRVGRVYYPALKSHQGHRFLGT
QMRRAGGVIAFELKSDIEGSINFVDSLKVFTIAVSLGDAESLIQHPASMTHSPYTPEARL
EAGITDTLLRISVGLEDVDDLIADLSQALAKI