Protein Info for Sama_1236 in Shewanella amazonensis SB2B

Annotation: psp operon transcriptional activator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF00158: Sigma54_activat" amino acids 10 to 173 (164 residues), 202.1 bits, see alignment E=1.3e-63 TIGR02974: psp operon transcriptional activator" amino acids 10 to 351 (342 residues), 547.5 bits, see alignment E=5.8e-169 PF14532: Sigma54_activ_2" amino acids 11 to 181 (171 residues), 71.4 bits, see alignment E=2.4e-23 PF07728: AAA_5" amino acids 33 to 153 (121 residues), 31.8 bits, see alignment E=3.3e-11 PF01078: Mg_chelatase" amino acids 34 to 151 (118 residues), 21.5 bits, see alignment E=3.3e-08 PF02954: HTH_8" amino acids 311 to 351 (41 residues), 39.9 bits, see alignment 7e-14

Best Hits

KEGG orthology group: K03974, psp operon transcriptional activator (inferred from 100% identity to saz:Sama_1236)

Predicted SEED Role

"Psp operon transcriptional activator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S4Y7 at UniProt or InterPro

Protein Sequence (357 amino acids)

>Sama_1236 psp operon transcriptional activator (RefSeq) (Shewanella amazonensis SB2B)
MPNAFKQDNLIGQSNALLEVLEHVSRIAPLSKPVLIIGERGTGKELIAERLHYLSQRWDQ
SFLKLNCSSLSENLLESELFGHESGAFTGAKGRHEGRFERADGGTLFLDELANTSGLIQE
KLLRVIEYGEYERVGGSKTLQADVRLICAANEDLPSLAEAGEFRADLLDRLAFDVITLPP
LRSRKEDIMPLAEYFGVGMARQLKLEYFPGFAPHAIEQLLSHQWPGNIRELKNVIERSVY
RSGADGEPIEHIVLDPFDSPWRPKGRIKTRERQVQPALAPEPKSEPTFATTAAVSECAPT
PSFPLDLKEHLEAVEKDLIQQALAASQFNQKKSADMLGLSYHQLRGILKKYNLLDKA