Protein Info for Sama_1231 in Shewanella amazonensis SB2B

Annotation: peptide ABC transporter, ATP-binding protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF00005: ABC_tran" amino acids 31 to 178 (148 residues), 110.6 bits, see alignment E=9.6e-36 PF13401: AAA_22" amino acids 43 to 209 (167 residues), 30.5 bits, see alignment E=4e-11

Best Hits

Swiss-Prot: 52% identical to SAPF_SHIFL: Peptide transport system ATP-binding protein SapF (sapF) from Shigella flexneri

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to saz:Sama_1231)

MetaCyc: 52% identical to putrescine ABC exporter ATP binding protein SapF (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-328 [EC: 7.6.2.16]

Predicted SEED Role

"Peptide transport system ATP-binding protein SapF"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S4Y2 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Sama_1231 peptide ABC transporter, ATP-binding protein (RefSeq) (Shewanella amazonensis SB2B)
MTTPLLKVTSLSKRYFTGYHRFKRQYNEALAPISFELGRGETLAIVGEAGSGKSTLARIL
VGAEQRSSGDIQFEGESLESRNLKQRCRLIRMIFQDPNTSLNPRLSIGELLEEPLRFNTG
MSAHERSVQVTETLRKVGLLPEHADFYPHMISEGQKQRVAVARALMLSPKVIIADEALTA
LDLSVRSQILNLLLHLQKEMGLSYIFVSHNLNLVRHVSDKIMVLHKGQLIEKGPVQKVFE
SPEHEYTARLIAEQTRQVRKR