Protein Info for Sama_1229 in Shewanella amazonensis SB2B

Annotation: putative uracil-DNA glycosylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00628: uracil-DNA glycosylase
  • amino acids 2 to 210 (209 residues), 275.1 bits, E=2.2e-86
• PF03167: UDG
  • amino acids 46 to 206 (161 residues), 57.5 bits, E=8.3e-20

Best Hits

Swiss-Prot: 62% identical to UNG_YERPA: Uracil-DNA glycosylase (ung) from Yersinia pestis bv. Antiqua (strain Antiqua)

KEGG orthology group: K03648, uracil-DNA glycosylase [EC: 3.2.2.-] (inferred from 100% identity to saz:Sama_1229)

MetaCyc: 62% identical to uracil-DNA glycosylase (Escherichia coli K-12 substr. MG1655)
RXN0-2584 [EC: 3.2.2.27]

Predicted SEED Role

"Uracil-DNA glycosylase, family 1" in subsystem DNA Repair Base Excision

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-, 3.2.2.27

Use Curated BLAST to search for 3.2.2.- or 3.2.2.27

Sequence Analysis Tools

See A1S4Y0 at UniProt or InterPro

Protein Sequence (218 amino acids)

>Sama_1229 putative uracil-DNA glycosylase (RefSeq) (Shewanella amazonensis SB2B)
MDWQQLLGDEKRSAYFQDTLKYINERIRAGVTVYPAKADIFNAFRFTPLEQVKVVILGQD
PYHGPNQAHGLCFSVKSPCPPPPSLQNIFIELTNSIPGFIAPSHGDLTPWATQGVLLLNT
ILTVERGQAHSHAHLGWERFTDAVIRGISTHCHGVIFLLWGSHAGKKAGLIDGSRHRVLQ
APHPSPFSAHKGFFGCNHFAIANDMLRHQGKSPIEWQL