Protein Info for Sama_1225 in Shewanella amazonensis SB2B

Name: clpX
Annotation: ATP-dependent protease ATP-binding subunit ClpX (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 TIGR00382: ATP-dependent Clp protease, ATP-binding subunit ClpX" amino acids 12 to 412 (401 residues), 703.3 bits, see alignment E=5.2e-216 PF06689: zf-C4_ClpX" amino acids 14 to 50 (37 residues), 70.4 bits, see alignment 3.8e-23 PF07724: AAA_2" amino acids 112 to 310 (199 residues), 118.5 bits, see alignment E=1.3e-37 PF07728: AAA_5" amino acids 114 to 191 (78 residues), 26.5 bits, see alignment E=2.3e-09 PF00004: AAA" amino acids 115 to 220 (106 residues), 57.9 bits, see alignment E=6e-19 PF10431: ClpB_D2-small" amino acids 317 to 394 (78 residues), 48.6 bits, see alignment E=2.8e-16

Best Hits

Swiss-Prot: 100% identical to CLPX_SHEAM: ATP-dependent Clp protease ATP-binding subunit ClpX (clpX) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K03544, ATP-dependent Clp protease ATP-binding subunit ClpX (inferred from 100% identity to saz:Sama_1225)

MetaCyc: 81% identical to ATP-dependent Clp protease ATP-binding subunit ClpX (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpX" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S4X6 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Sama_1225 ATP-dependent protease ATP-binding subunit ClpX (RefSeq) (Shewanella amazonensis SB2B)
MGENKTGDGGKLLYCSFCGKSQHEVRKLIAGPSVYVCDECVELCNDIIREEIKEISPKRD
QDKLPTPHELRAHLDDYVIGQEKAKKVLSVAVYNHYKRLRNAGPKDGVELGKSNILLIGP
TGSGKTLLAETLARFLNVPFTMADATTLTEAGYVGEDVENIIQKLLQKCDYDVEKAQRGI
VYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVAAVPPQGGRKHPQQEFLQVDT
SKILFICGGAFAGLEKVIEQRTHTGSGIGFGAQVKGKEEKESMSDILSQVEPEDLVKYGL
IPEFIGRLPVVATLAELDEDALIQILSEPKNALTKQYAALFEMENVELEFREDALKAIAQ
KAMSRKTGARGLRSIVEGILLDTMYDLPSQQGVSKAVVDESVVKGESAPILIYEQTESQA
ASGDQ