Protein Info for Sama_1182 in Shewanella amazonensis SB2B

Annotation: 3-oxoacyl-(acyl carrier protein) synthase III (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 84% identical to OLEA_SHEON: Acyl-CoA:acyl-CoA alkyltransferase (oleA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to saz:Sama_1182)

MetaCyc: 84% identical to fatty acyl-CoA transferase OleA (Shewanella oneidensis MR-1)
RXN-18560 [EC: 2.3.3.20]

Predicted SEED Role

"3-oxoacyl-[ACP] synthase III in alkane synthesis cluster"

MetaCyc Pathways

superpathway of fatty acids biosynthesis (E. coli) (50/53 steps found)
superpathway of fatty acid biosynthesis II (plant) (37/43 steps found)
superpathway of fatty acid biosynthesis I (E. coli) (13/16 steps found)
hentriaconta-3,6,9,12,15,19,22,25,28-nonaene biosynthesis (3/4 steps found)
fatty acid biosynthesis initiation (type II) (2/3 steps found)
superpathway of fatty acid biosynthesis initiation (3/5 steps found)
streptorubin B biosynthesis (20/34 steps found)

KEGG Metabolic Maps

Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180 or 2.3.3.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S4T3 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Sama_1182 3-oxoacyl-(acyl carrier protein) synthase III (RefSeq) (Shewanella amazonensis SB2B)
MKYSRVFINSMAYELAPVVVSSSELEQRLAPLYQKFRIPMGQLAALTGIRERRWWPLGHQ
LSDGAIAAAKKALNETGLKATDLGAVVYTGVCRDQHEPATACRIAASLGVGRDSAIYDIS
NACLGVLSGILDIANRIELGQIRAGLVVSCESARDIVDATIERMLEEPTMQNFAQSLATL
TGGSGAVAVLLTDGSFNLATERNHQLLGASQLAAPEHYQLCQWGLQEAGHRLYREFMRTD
AVALLKEGVELAKQTWQHFLGQREWLASQVDKVICHQVGAANRKQVLSALQIPEEKEFPT
FAELGNMGTVSLPVSAAIAHDQGFLRPGDQVSFLGIGSGLNCMMLGLRW