Protein Info for Sama_1177 in Shewanella amazonensis SB2B

Annotation: proton-dependent oligopeptide transporter (POT) family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 transmembrane" amino acids 22 to 40 (19 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 176 to 199 (24 residues), see Phobius details amino acids 220 to 238 (19 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details amino acids 392 to 414 (23 residues), see Phobius details amino acids 426 to 447 (22 residues), see Phobius details amino acids 467 to 488 (22 residues), see Phobius details TIGR00924: amino acid/peptide transporter (Peptide:H+ symporter)" amino acids 6 to 478 (473 residues), 334.1 bits, see alignment E=8.7e-104 PF07690: MFS_1" amino acids 28 to 440 (413 residues), 55.4 bits, see alignment E=5e-19 PF00854: PTR2" amino acids 80 to 451 (372 residues), 205.2 bits, see alignment E=1.6e-64

Best Hits

KEGG orthology group: K03305, proton-dependent oligopeptide transporter, POT family (inferred from 100% identity to saz:Sama_1177)

Predicted SEED Role

"Di-/tripeptide transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S4S8 at UniProt or InterPro

Protein Sequence (506 amino acids)

>Sama_1177 proton-dependent oligopeptide transporter (POT) family protein (RefSeq) (Shewanella amazonensis SB2B)
MTTGNTQVSKTRSFMTVSLIELWERFGFYGMQALIVYFMVQRLGFADERANLVWSACAAL
IYVAPAIGGWVGDKVLGTKRTMLLGAGILTLGYALMAVPTDNTWFLFSALGVIVVGNGLF
KPNAGNLVRKIYDGDDSKIDSAFTIYYMAVNVGSTFSMLLTPWIKDYVNANYGDGFGWHA
AFAVCFVGLIVGIGNYMMMRHTLDNYGSEPDLLPVDKRKLAAVLGASLLAVVVSAVILEF
EDIARVFVYGAGLVVLGIFIHLIRTSEESERAGLLAALVLTLQSVFFFIFYQQMSTSLAL
FALRNVDWDFVVMGQHLWTWSPAQFQALNPIWIMVLSPILAWAYAWGGKHNKDISIAAKF
ALGFAVVAAGFFIYSVAGEFAVNGKTSSWVMIWGYGAYSLGELLVSGLGLAMIARYVPER
MGGFMMGAYFVATGISQYLGGVVANFASVPQGITNPLETLTIYTSLFNKLGFAALGCTLI
ALAVLPLMRRLTETHHSHNGSDQVGA