Protein Info for Sama_1155 in Shewanella amazonensis SB2B

Annotation: cell cycle protein MesJ (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 29 to 213 (185 residues), 158.2 bits, see alignment E=2.4e-50 PF01171: ATP_bind_3" amino acids 30 to 209 (180 residues), 161.1 bits, see alignment E=3.8e-51 PF09179: TilS" amino acids 263 to 330 (68 residues), 51.1 bits, see alignment E=2.1e-17 PF11734: TilS_C" amino acids 423 to 485 (63 residues), 74.3 bits, see alignment E=5.9e-25 TIGR02433: tRNA(Ile)-lysidine synthetase, C-terminal domain" amino acids 430 to 462 (33 residues), 33.1 bits, see alignment (E = 2.9e-12)

Best Hits

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 100% identity to saz:Sama_1155)

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S4Q6 at UniProt or InterPro

Protein Sequence (497 amino acids)

>Sama_1155 cell cycle protein MesJ (RefSeq) (Shewanella amazonensis SB2B)
MQTSPAAVATLDSLVLLIEAALAGLTPSKLVLGYSGGLDSELMACALSHYAKKHPGTQCL
LVHVHHGLSPNADTWARHCEHRAARYELEFVLEKVRVKQGARLSLEAEARSARYAALMAH
LAEGDVLLTAHHQDDQLETVLLALARGLGPKGLAAMGQQQSLDDGAFQVRPFLGLSREYL
EDAASALDLSHIEDESNQDTRFDRNFLRAEIIPRLKSRWGAIGATASRSAELCAQTQMLL
DDEVSERLTPLISRCPLSHAFRLALGPVAASSRAWQAQLVRGFLEVAGLPPPSKIQLDEA
LSQLFAAKADAAVSLRFGRTRLRRYQGWLYAETESDNASHSLSGSTKTSATKTSATQTSA
TQTPFRQTPVTQQMLAEGIATPLGKLQLLPTDAENEGQDAHYWQARVPLGALIGDLTLVY
GLPGSTKAWPVGRGKQRELKKLWQEFDVPPWLRISIPMLCCDEALVAAAGVWVEKTALEK
SSQQESEDWLTIRLLRI