Protein Info for Sama_1120 in Shewanella amazonensis SB2B

Name: queF
Annotation: 7-cyano-7-deazaguanine reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 TIGR03138: queuine synthase" amino acids 25 to 296 (272 residues), 409.8 bits, see alignment E=3.1e-127 PF14819: QueF_N" amino acids 36 to 145 (110 residues), 162.9 bits, see alignment E=3.2e-52 PF14489: QueF" amino acids 210 to 282 (73 residues), 71.9 bits, see alignment E=4.3e-24

Best Hits

Swiss-Prot: 82% identical to QUEF_SHEFN: NADPH-dependent 7-cyano-7-deazaguanine reductase (queF) from Shewanella frigidimarina (strain NCIMB 400)

KEGG orthology group: K06879, 7-cyano-7-deazaguanine reductase [EC: 1.7.1.13] (inferred from 100% identity to saz:Sama_1120)

Predicted SEED Role

"NADPH dependent preQ0 reductase (EC 1.7.1.13)" (EC 1.7.1.13)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.7.1.13

Use Curated BLAST to search for 1.7.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S4M1 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Sama_1120 7-cyano-7-deazaguanine reductase (RefSeq) (Shewanella amazonensis SB2B)
MCPYFDTERCLMTRNHDPYSGAAELEGLTLGQTTEYQAEYAPSLLQGVPRKLNRDAIALT
GTLPFHGTDLWTGYELSWLNAKGKPMVAILDVQLDVNSENLIESKSFKLYLNSFNQTRFD
SVEAVSRTLEKDLAQCANGEVKVKVIEPKYFGLARIVELPGTCIDDLDIEVDNYDFNPDY
LENSTDDKQLVAETLNSNLLKSNCLITSQPDWGSVMIRYQGPKIDREKLLRYLISFRQHN
EFHEQCVERIFTDLKHYCGCSKLTVFARYTRRGGLDINPFRSDFEHLPENNRLARQ