Protein Info for Sama_1112 in Shewanella amazonensis SB2B

Annotation: omega-3 polyunsaturated fatty acid synthase PfaD (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02814: PfaD family protein
  • amino acids 75 to 512 (438 residues), 701.7 bits, E=1.9e-215
• PF03060: NMO
  • amino acids 88 to 371 (284 residues), 36.2 bits, E=4.8e-13
• PF21607: FabD_helical_ins
  • amino acids 389 to 468 (80 residues), 120.9 bits, E=2e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_1112)

MetaCyc: 80% identical to icosapentaenoate synthase PfaD subunit (Photobacterium profundum SS9)
2.3.1.-

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [FMN] (EC 1.3.1.9), inferred for PFA pathway" (EC 1.3.1.9)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (50/53 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of fatty acid biosynthesis II (plant) (37/43 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (20/20 steps found)
• biotin biosynthesis I (14/15 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (9/9 steps found)
• 8-amino-7-oxononanoate biosynthesis I (10/11 steps found)
• (5Z)-dodecenoate biosynthesis I (6/6 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (13/16 steps found)
• cis-vaccenate biosynthesis (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• (5Z)-dodecenoate biosynthesis II (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• fatty acid elongation -- saturated (4/5 steps found)
• icosapentaenoate biosynthesis IV (bacteria) (1/1 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (20/205 steps found)
• superpathway of mycolate biosynthesis (21/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.3.1.9

Use Curated BLAST to search for 1.3.1.9

Sequence Analysis Tools

See A1S4L3 at UniProt or InterPro

Protein Sequence (537 amino acids)

>Sama_1112 omega-3 polyunsaturated fatty acid synthase PfaD (RefSeq) (Shewanella amazonensis SB2B)
MSTAFKWPWAIDQASGISHVDAFKSALLELNKPLYVARLPGGELCLSHDASEQQPEQGRE
PGLLPVAAFAAPFAACELGSEDFRRCHGVKYAYYAGAMANGIASEELVIALGKAGILCSF
GAAGLVPARVEAAIKRIQAELPQGPYAFNLIHSPSEPALEQGAVELYLKHGVHTVEASAF
LALTPHIVRYRAAGLSRDNDGNIVIKNKVIAKISRTEVASHFMKSAPKKMLDTLVAEGHI
STEQAELALLVPMADDITAEADSGGHTDNRPLVTLLPTILALRDELATSQSFATPIRVGA
GGGIGTPDAALAAFNMGADFIVTGSINQACIEAGASEHTRKLLATTEMADVTMAPAADMF
EMGVKLQVVKRGTLFPMRANKLYEIYSRYDSIEAIPADERQKLEAQVFRASLDDIWQGTV
AHFMERDPSQIQRAEGNPKRKMALIFRWYLGLSSRWSNTGEAGREMDYQIWAGPALGAFN
GWSKGTYLDDYRERRAVDLALHLLSGAAYLHRVNSLKAQGIVLPSAVARYRPLEPLA