Protein Info for Sama_1103 in Shewanella amazonensis SB2B

Annotation: signal transduction histidine kinase-like protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 147 to 164 (18 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details PF20966: MASE6" amino acids 123 to 220 (98 residues), 28.6 bits, see alignment E=2.2e-10 PF00512: HisKA" amino acids 254 to 316 (63 residues), 38.5 bits, see alignment E=1.5e-13 PF02518: HATPase_c" amino acids 366 to 475 (110 residues), 73.5 bits, see alignment E=2.7e-24

Best Hits

KEGG orthology group: K07642, two-component system, OmpR family, sensor histidine kinase BaeS [EC: 2.7.13.3] (inferred from 100% identity to saz:Sama_1103)

Predicted SEED Role

"Sensory histidine kinase BaeS"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S4K4 at UniProt or InterPro

Protein Sequence (478 amino acids)

>Sama_1103 signal transduction histidine kinase-like protein (RefSeq) (Shewanella amazonensis SB2B)
MFQFLRDIRLFSDTESLNGIALKRRQLVLNGLLLTIILLLSVFAIYNQFRGMWQIAALDL
CALAACLFAYIRLRLSHRLPRQTPHGDNTQNGHRPDDPQVAQDTDALAHNKQRNGAQLNI
LNSTSLLVSLILMLFLWALAWQGQAENFSLIWTFFLPVFVFMLNGRALGASLVAVFYLVL
FTMAFSQLGQWQAGAWDQVSLIRFVLASLVMVFTCYFSELTLNQAHLELKKSHAESERLL
QDRNALMLDTLVKQQKLLTDVSHELRTPLSVLRMKLEAMQDGVMAPSSANIEGLLKHMQQ
LDAFISDLSRASKLDQTRLDGNAVRVELHDFLSDWINRFQDSVAGRGLQLTLDLTRSHPP
CPALLDETSFELALGKLMENSLRYTQAPGSIRLSLCRRGDVIVITLEDSAPGVAADQLER
LFEPLYRLEDSRSRDTGGAGLGLSVAKSIILAHQGQIHASLSPLGGLRMVITLPALAD