Protein Info for Sama_1093 in Shewanella amazonensis SB2B

Annotation: fumarylacetoacetate (FAA) hydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01557: FAA_hydrolase
  • amino acids 15 to 191 (177 residues), 105.9 bits, E=1.3e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_1093)

Predicted SEED Role

"2-keto-4-pentenoate hydratase (EC 4.2.1.80)" (EC 4.2.1.80)

MetaCyc Pathways

• 2-hydroxypenta-2,4-dienoate degradation (2/3 steps found)
• catechol degradation I (meta-cleavage pathway) (2/5 steps found)
• catechol degradation II (meta-cleavage pathway) (2/7 steps found)
• toluene degradation I (aerobic) (via o-cresol) (2/7 steps found)
• toluene degradation V (aerobic) (via toluene-cis-diol) (2/7 steps found)
• toluene degradation II (aerobic) (via 4-methylcatechol) (1/6 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (2/8 steps found)
• p-cumate degradation (2/8 steps found)
• meta cleavage pathway of aromatic compounds (2/10 steps found)
• 4-chloronitrobenzene degradation (1/9 steps found)
• L-tryptophan degradation IX (3/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (3/12 steps found)
• p-cymene degradation (2/11 steps found)
• naphthalene degradation to acetyl-CoA (2/12 steps found)
• toluene degradation IV (aerobic) (via catechol) (2/13 steps found)
• mandelate degradation to acetyl-CoA (3/18 steps found)
• superpathway of aerobic toluene degradation (4/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (6/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (5/42 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Carbazole degradation
• Ethylbenzene degradation
• Fluorene degradation
• Phenylalanine metabolism
• Styrene degradation
• Toluene and xylene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.80

Sequence Analysis Tools

See A1S4J4 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Sama_1093 fumarylacetoacetate (FAA) hydrolase (RefSeq) (Shewanella amazonensis SB2B)
MKQVFLSGRAVSPSKVVCIGRNYVAHAEELGNEVPSEPVVFVKPASAIGNVLHSTQGEVL
HYEAEICFMVARGQLVAASVGLDLTKRATQNRLKAKGLPWERAKAFDGSALFGEFVPCTS
SEGLSLVFSCDGVILQQGGCELMLFSPEQLLEEIGSFMTLEDGDILMTGTPAGVGPLQAG
GHYRAELRCGDELLTSVSWTAH