Protein Info for Sama_1081 in Shewanella amazonensis SB2B

Annotation: magnesium transporter, putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 291 to 311 (21 residues), see Phobius details amino acids 317 to 344 (28 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details amino acids 392 to 418 (27 residues), see Phobius details amino acids 430 to 453 (24 residues), see Phobius details PF03448: MgtE_N" amino acids 41 to 141 (101 residues), 66.5 bits, see alignment E=4.2e-22 PF00571: CBS" amino acids 208 to 256 (49 residues), 32.5 bits, see alignment 1.4e-11 PF01769: MgtE" amino acids 325 to 448 (124 residues), 106.4 bits, see alignment E=2e-34

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 100% identity to saz:Sama_1081)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S4I2 at UniProt or InterPro

Protein Sequence (454 amino acids)

>Sama_1081 magnesium transporter, putative (RefSeq) (Shewanella amazonensis SB2B)
MPEQEPNLAPQNEVGLVVQQLTGAEGQAQAEVFSEILEDAEPGTVALLLEALPLDERYER
WQQVEFADRVEVLSLMRADPRMGILRRMPDDEVDLLFAQLSPEDLIEWSDYLPESFTDRA
LAQMGERQRQHFELYNQYSENEIGRYADHQMLVLSTKATIGQAQRFFRRIELDCNDSLFL
VDEEDHFRGAVSRYEVFRSNPDEPLLSLMDEDSRAISADATLMEAAELLEHSRDVELPVV
DDEGGLIGRVTLRTATELVREHYEAQLMASAGMNETDDLFAPIMKGARRRAVWLGINLLT
AFLASATIGLFEDVLSQVVALAVLMPIVASMGGIAGSQSLTLMIRGMAMGQISAGNLWSL
MKNELGIGAVNGVLWAIVIGAVSGWWFSNEIIGIAIGCAILINMLVAAGAGVLVPMVLQK
MDQDPALSGSVILTTVTDVIGFLSFLGLATILFL