Protein Info for Sama_1049 in Shewanella amazonensis SB2B

Annotation: aspartate kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF00696: AA_kinase" amino acids 4 to 230 (227 residues), 170.1 bits, see alignment E=1e-53 TIGR00657: aspartate kinase" amino acids 64 to 398 (335 residues), 330.8 bits, see alignment E=7.6e-103 PF22468: ACT_9" amino acids 340 to 398 (59 residues), 45.1 bits, see alignment E=1.1e-15

Best Hits

Swiss-Prot: 46% identical to AKLYS_PSEU5: Aspartate kinase Ask_LysC (lysC) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 100% identity to saz:Sama_1049)

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.4

Use Curated BLAST to search for 2.7.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S4F0 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Sama_1049 aspartate kinase (RefSeq) (Shewanella amazonensis SB2B)
MTKIYVKKFGGTSVGTFERIEAVADAIAKAHFEGERQVLVLSAMAGETNRLYAMAANIDP
LAPARELDMLVSAGEQVSIALMSIALARRGVNARSLLGSQVKVRTNSQFGRASIESVDTG
LLMQLLDEGAVPVIAGFQGVNEQGDVTTLGRGGSDTTAVAIAAALEAAECQIFTDVTGVF
TTDPNIDPDAQKLDSISFEAMYEMARQGAKVLHPDSVACARRHGVVLRVLSSFESGSGTL
IRFDEPEHSGSGIVGIAVTRGQGLVSVAGLVDQPQAEVALFQALANASVDTDLVVQLAEE
KALAFTLAQGALDKVLTLIDRLALEQPLADVRHESPLAKVSLVSTGKAVMAEVGARVTEL
LEAQNIRVKLLSTSEIKLSVVIDEVHLQHAVRSLHRAFDLNKV