Protein Info for Sama_1045 in Shewanella amazonensis SB2B

Annotation: DNA mismatch repair protein MutS (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 854 TIGR01070: DNA mismatch repair protein MutS" amino acids 12 to 851 (840 residues), 1230.6 bits, see alignment E=0 PF01624: MutS_I" amino acids 13 to 124 (112 residues), 147.9 bits, see alignment E=3.3e-47 PF05188: MutS_II" amino acids 133 to 257 (125 residues), 113.8 bits, see alignment E=2e-36 PF05192: MutS_III" amino acids 274 to 563 (290 residues), 179.3 bits, see alignment E=3e-56 PF05190: MutS_IV" amino acids 432 to 521 (90 residues), 99.8 bits, see alignment E=2.3e-32 PF00488: MutS_V" amino acids 614 to 801 (188 residues), 297.9 bits, see alignment E=8.8e-93

Best Hits

Swiss-Prot: 70% identical to MUTS_CROS8: DNA mismatch repair protein MutS (mutS) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 67% identity to eam:EAMY_0767)

MetaCyc: 69% identical to DNA mismatch repair protein MutS (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S4E6 at UniProt or InterPro

Protein Sequence (854 amino acids)

>Sama_1045 DNA mismatch repair protein MutS (RefSeq) (Shewanella amazonensis SB2B)
MNSTDLLDLEKHTPMMRQYLTMKAAHPDMLLFYRMGDFYELFYDDAKRASEMLSISLTAR
GKSGGDPIPMAGIPYHAVEGYLAKLVQLGQSVAICEQIGDPATAKGPVERKVVRVVTPGT
LTDEALLQERQDNLLAAVYQGKVGYGFATLDVASGRFVIAELPSREALEAELQRTSPAEL
LYSEDFGDMGLINHIRGKRRRPEWEFDYDTCIKMLLEQFGTRDLRGFGIADARLSLQAAG
CLMQYVKDTQRTALPHINSIVRFNQGDSIILDAATRRNLELTVSLSGSRENTLASVLDNT
VTAMGSRMLQRWIHQPLRCHDTIRGRQQAVQELLETGLYEDLRAELKALGDIERILARLA
LRSARPRDFARLRDALGILPLIRERLQRCDARHLKSLNILLGDFPEEYELLCRAIVDNPP
VLIRDGGVIREGYDSELDEWRKLSDGGIDYLEQMELREKERTGIATLKVGFNRVHGYYIE
VSRAQSALVPIAYQRRQTLKNTERYITPELKEYEEKVLSSQGKALALEKQLWEELFDLIL
PKLQELQDFALAASELDVLANFADRADLFNYHCPELSDTTGILIEAGRHPVVERVSQSPF
IPNPVELSNHRRMLIVTGPNMGGKSTYMRQVALITLMAHIGSFVPAERALIGPVDRIFTR
IGASDDLASGRSTFMVEMTETANILHNATANSLVLMDEIGRGTSTYDGMSLAWSAAEYLA
QKLGAMTLFATHYFELTQLPEMLPGVHNVHLDAIEHDDTIAFMHAVQEGAASKSYGLQVA
ALAGVPANVIKAAKHKLLQLESRDHGVDMSKQQALPLTMTPEPSAAELRLEAIDPNDLSP
RQALELLFELKRLL