Protein Info for Sama_1034 in Shewanella amazonensis SB2B

Name: mazG
Annotation: nucleoside triphosphate pyrophosphohydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00444: MazG family protein
  • amino acids 21 to 268 (248 residues), 339.2 bits, E=8.2e-106
• PF03819: MazG
  • amino acids 38 to 111 (74 residues), 97.3 bits, E=5e-32
  • amino acids 178 to 237 (60 residues), 33.6 bits, E=3.9e-12
• PF01503: PRA-PH
  • amino acids 176 to 231 (56 residues), 27.6 bits, E=3e-10

Best Hits

Swiss-Prot: 57% identical to MAZG_ECOLI: Nucleoside triphosphate pyrophosphohydrolase (mazG) from Escherichia coli (strain K12)

KEGG orthology group: K02428, nucleoside-triphosphate pyrophosphatase [EC: 3.6.1.19] (inferred from 100% identity to saz:Sama_1034)

MetaCyc: 57% identical to nucleoside triphosphate pyrophosphohydrolase (Escherichia coli K-12 substr. MG1655)
Nucleotide diphosphatase. [EC: 3.6.1.9]

Predicted SEED Role

"Nucleoside triphosphate pyrophosphohydrolase MazG (EC 3.6.1.8)" (EC 3.6.1.8)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (14/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (7/7 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• dZTP biosynthesis (3/5 steps found)
• pyrimidine deoxyribonucleotides dephosphorylation (1/3 steps found)
• tunicamycin biosynthesis (1/9 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Nicotinate and nicotinamide metabolism
• Pantothenate and CoA biosynthesis
• Purine metabolism
• Pyrimidine metabolism
• Riboflavin metabolism
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.19 or 3.6.1.8 or 3.6.1.9

Sequence Analysis Tools

See A1S4D5 at UniProt or InterPro

Protein Sequence (275 amino acids)

>Sama_1034 nucleoside triphosphate pyrophosphohydrolase (RefSeq) (Shewanella amazonensis SB2B)
MSTEIIANEEPNADINPLLAIMAKLRDPKHGCPWDKAQRFETIVPFTLEEAYEVADTIER
MDLDELPDELGDLLFQVVFYCQLGKEQGLFDFDEVVKRICAKLTSRHPHVFGDIEVSSSK
EVKDNWEAIKASERKAKDKHSVLDDVPVGLPALSRAAKIQKRVARVGFDWGELPPVVAKV
EEEIAEVLAEVQVDSPDQERVASEMGDLLFAVVNMARHLGVEPEQALRRANQKFERRFRG
VEELATLGGRQLTDYSLAELDGFWDQVKEQEKSPR