Protein Info for Sama_1027 in Shewanella amazonensis SB2B

Annotation: transporter, putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 62 to 83 (22 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 123 to 147 (25 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 291 to 313 (23 residues), see Phobius details PF03547: Mem_trans" amino acids 6 to 145 (140 residues), 38.4 bits, see alignment E=2.9e-14 amino acids 163 to 306 (144 residues), 54.1 bits, see alignment E=5e-19

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 100% identity to saz:Sama_1027)

Predicted SEED Role

"TRANSPORTER"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S4C8 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Sama_1027 transporter, putative (RefSeq) (Shewanella amazonensis SB2B)
MFNLLIPLLAVVAVMIAGAASSRLLPGWLERFLNQYVYYLAFPAILYVSLAKTPIEQILN
PGFVLGYLLAMVVTYVLVQLWSLKHEQGQPRPASLRALSATFGNTAFIGIPVLAMLFPDN
PQALMAAALASLLSVLMFAVTVVQLRLASQPLTGIARLSLALRVVSRNPVVIGCALGVLA
SAMQFSLPPILEPLVTWIGKSSSPCALFAIGIALARSMREPEHSRVGVPFWHVNLAKLAL
QPLLVWLLFSWFGVDTQLTVMGVLLSAMPTAASVYLLAYQDKTLEKQIARGIVAGTLLTL
FSLPLLTMGLNLITQ